Healthy Little Vittles
Gluten-Free, Vegan, Plant-Based Recipes
  • Recipes
    • All books and ebooks Breakfast Dessert Drinks Grain-Free Homemade Condiments Lunch & Dinner No-Bake Desserts Recipe Roundups Salads Side Dishes Smoothies + Smoothie Bowls Snacks & Appetizers Soups
      Dessert

      Vegan Cast Iron S’mores Dip

      May 26, 2022

      Breakfast

      Blueberry Spinach Spirulina Smoothie

      May 20, 2022

      Dessert

      Strawberries and Cream Quinoa Cookies (No-Bake!)

      May 10, 2022

      Breakfast

      Gluten-Free Vegan French Crepes

      May 2, 2022

      Dessert

      Lavender Vanilla Oatmeal Shortbread Cookies

      May 1, 2022

      Breakfast

      Grain-Free Banana Bread Donuts

      April 24, 2022

      Dessert

      Vegan Lemon Bars with Graham Granola Crust

      April 18, 2022

      Dessert

      Chocolate Avocado Pudding Dirt Cups

      April 15, 2022

      books and ebooks

      The Beginner’s Guide to Gluten-Free Vegan Baking

      September 16, 2021

      books and ebooks

      7-Day Vegan Challenge eBook

      December 28, 2020

      books and ebooks

      Moon Milk by Gina Fontana

      May 11, 2019

      Breakfast

      Blueberry Spinach Spirulina Smoothie

      May 20, 2022

      Breakfast

      Gluten-Free Vegan French Crepes

      May 2, 2022

      Breakfast

      Grain-Free Banana Bread Donuts

      April 24, 2022

      Breakfast

      Strawberries and Cream Breakfast Quinoa

      April 7, 2022

      Breakfast

      Blueberry Overnight Quinoa

      March 6, 2022

      Breakfast

      Anti-Inflammatory Vegan Green Smoothie

      February 25, 2022

      Breakfast

      Four Seed Homemade Vegan Protein Bars (no-bake)

      January 27, 2022

      Breakfast

      Grain-Free Cinnamon Sugar Donuts

      January 10, 2022

      Dessert

      Vegan Cast Iron S’mores Dip

      May 26, 2022

      Dessert

      Strawberries and Cream Quinoa Cookies (No-Bake!)

      May 10, 2022

      Dessert

      Lavender Vanilla Oatmeal Shortbread Cookies

      May 1, 2022

      Dessert

      Vegan Lemon Bars with Graham Granola Crust

      April 18, 2022

      Dessert

      Chocolate Avocado Pudding Dirt Cups

      April 15, 2022

      Dessert

      Grain-Free Lemon Cupcakes (Vegan)

      April 3, 2022

      Dessert

      Crispy Quinoa Cacao Cookies (No-Bake!)

      March 28, 2022

      Dessert

      Quinoa Chocolate Chip Cookies

      March 2, 2022

      Drinks

      Purple Passion Blender Juice

      June 8, 2020

      Drinks

      Orange Sunrise Blender Juice

      May 3, 2020

      Drinks

      Blender Beet Juice

      April 21, 2020

      Drinks

      Blender Green Juice

      April 5, 2020

      Drinks

      Iced Matcha Dalgona Latte

      April 3, 2020

      Drinks

      Matcha Latte

      February 26, 2020

      Drinks

      Moon Milk by Gina Fontana

      May 11, 2019

      Drinks

      Vegan Italian Cream Sodas

      February 16, 2019

      Grain-Free

      Grain-Free Banana Bread Donuts

      April 24, 2022

      Grain-Free

      Quinoa Chocolate Chip Cookies

      March 2, 2022

      Grain-Free

      Grain-Free Vanilla Cupcakes with Blackberry Frosting

      February 6, 2022

      Grain-Free

      Grain-Free Cinnamon Sugar Donuts

      January 10, 2022

      Grain-Free

      Grain-Free Marbled Snowflake Sugar Cookies

      December 22, 2021

      Grain-Free

      Grain-Free Vegan Cinnamon Streusel Muffins

      August 15, 2021

      Grain-Free

      Vegan Grain-Free S’mores Brownies

      June 18, 2021

      Grain-Free

      Grain-Free Cherry Pop Tarts

      June 8, 2021

      Homemade Condiments

      How to Make Vegan Buttermilk

      April 11, 2022

      Homemade Condiments

      Easy Vegan Lemon Curd (Refined Sugar-Free)

      March 24, 2022

      Homemade Condiments

      Pumpkin BBQ Sauce

      December 9, 2021

      Homemade Condiments

      Golden Delicious Cinnamon Applesauce

      November 26, 2021

      Homemade Condiments

      Vegan Nacho Cheese Sauce (Nut-Free!)

      October 18, 2021

      Homemade Condiments

      Homemade Vegan Caramel Sauce

      September 27, 2021

      Homemade Condiments

      Naturally Sweetened Instant Pot Apple Butter

      October 1, 2020

      Homemade Condiments

      Cinnamon Sugar Cookie Cereal

      July 6, 2020

      Lunch & Dinner

      Creamy Alfredo Style Mushroom Pasta

      February 20, 2022

      Lunch & Dinner

      Easy Weeknight Mushroom Pho

      February 10, 2022

      Lunch & Dinner

      Maple Curry Garlic Ramen Noodle Bowls

      January 31, 2022

      Lunch & Dinner

      Sesame Kale Spring Rolls

      January 16, 2022

      Lunch & Dinner

      Vegan Latkes

      November 29, 2021

      Lunch & Dinner

      Roasted Broccoli Potato Tahini Soup

      October 29, 2021

      Lunch & Dinner

      Roasted Butternut Squash Carrot Soup

      October 14, 2021

      Lunch & Dinner

      Vegan Gluten-Free Chicken and Dumplings

      October 4, 2021

      No-Bake Desserts

      Strawberries and Cream Quinoa Cookies (No-Bake!)

      May 10, 2022

      No-Bake Desserts

      Crispy Quinoa Cacao Cookies (No-Bake!)

      March 28, 2022

      No-Bake Desserts

      Four Seed Homemade Vegan Protein Bars (no-bake)

      January 27, 2022

      No-Bake Desserts

      No-Bake Cherry Cake Pops

      July 19, 2021

      No-Bake Desserts

      No-Bake Vegan Cheesecake Ghosts

      October 22, 2020

      No-Bake Desserts

      Pumpkin Spice Chocolate Fudge

      September 7, 2020

      No-Bake Desserts

      No-Bake Peanut Butter Cup Bars

      May 26, 2020

      No-Bake Desserts

      Raw Chocolate Chip Cookie Dough Brownie Rolls

      February 24, 2020

      Recipe Roundups

      Vegan Thanksgiving Recipe Round-Up

      November 17, 2021

      Recipe Roundups

      25 Plant-Based, Gluten-Free, Vegan Recipe Roundup

      March 19, 2020

      Salads

      Thai Chopped Salad

      June 8, 2021

      Salads

      Watermelon Roasted Peach and Cobbed Corn Arugula Salad

      September 11, 2020

      Salads

      Green Bean Potato Salad

      August 17, 2020

      Salads

      Bourbon Cherry Kale Salad with Almond Oat Granola

      July 27, 2020

      Salads

      Creamy Grilled Romaine Salad

      March 19, 2020

      Salads

      Walnut Pear Sweet Potato Mason Jar Salads

      August 9, 2019

      Salads

      Spring Detox Mason Jar Salads

      April 6, 2019

      Salads

      Kaniwa Pear Salad

      March 10, 2019

      Side Dishes

      Vegan Latkes

      November 29, 2021

      Side Dishes

      Golden Delicious Cinnamon Applesauce

      November 26, 2021

      Side Dishes

      Gluten-Free Vegan Skillet Buttermilk Biscuits

      November 18, 2021

      Side Dishes

      Smoked Paprika Dill Potato Salad

      September 2, 2021

      Side Dishes

      Copycat True Food Kitchen Tahini Harissa Cauliflower

      August 23, 2021

      Side Dishes

      Gluten-Free, Vegan Green Bean Casserole

      November 10, 2020

      Side Dishes

      Browned Butter Bourbon Skillet Sweet Potatoes

      October 29, 2020

      Side Dishes

      Green Bean Potato Salad

      August 17, 2020

      Smoothies + Smoothie Bowls

      Blueberry Spinach Spirulina Smoothie

      May 20, 2022

      Smoothies + Smoothie Bowls

      Anti-Inflammatory Vegan Green Smoothie

      February 25, 2022

      Smoothies + Smoothie Bowls

      Cookie Monster Smoothie Bowl

      April 3, 2021

      Smoothies + Smoothie Bowls

      Vegan Pumpkin Pie Smoothie Bowl

      October 12, 2020

      Smoothies + Smoothie Bowls

      Peanut Butter Banana Dalgona Smoothie

      April 15, 2020

      Smoothies + Smoothie Bowls

      Strawberry Banana Sundae Smoothie Bowls

      January 25, 2019

      Snacks & Appetizers

      Crispy Quinoa Cacao Cookies (No-Bake!)

      March 28, 2022

      Snacks & Appetizers

      Baked Leftover Mashed Potato Croquettes

      February 15, 2022

      Snacks & Appetizers

      Four Seed Homemade Vegan Protein Bars (no-bake)

      January 27, 2022

      Snacks & Appetizers

      Pumpkin BBQ Sauce

      December 9, 2021

      Snacks & Appetizers

      Golden Delicious Cinnamon Applesauce

      November 26, 2021

      Snacks & Appetizers

      Vegan Nacho Cheese Sauce (Nut-Free!)

      October 18, 2021

      Snacks & Appetizers

      Strawberries and Cream Granola Bites

      May 10, 2021

      Snacks & Appetizers

      Carrot Cake Granola Bites

      March 29, 2021

      Soups

      Easy Weeknight Mushroom Pho

      February 10, 2022

      Soups

      Roasted Cauliflower Soup

      January 4, 2022

      Soups

      Roasted Broccoli Potato Tahini Soup

      October 29, 2021

      Soups

      Roasted Butternut Squash Carrot Soup

      October 14, 2021

      Soups

      Roasted Creamy Tomato Carrot Soup

      September 9, 2021

      Soups

      One-Pot Smoked Paprika Corn Chowder

      September 19, 2020

      Soups

      Spinach Artichoke Gnocchi Soup

      January 17, 2019

      Soups

      Curried Butternut Squash + Lentil Soup

      November 26, 2018

  • My Books
    • books and ebooks

      The Beginner’s Guide to Gluten-Free Vegan Baking

      September 16, 2021

      books and ebooks

      7-Day Vegan Challenge eBook

      December 28, 2020

      books and ebooks

      Moon Milk by Gina Fontana

      May 11, 2019

    • The Beginner’s Guide to Gluten-Free Vegan Baking
    • Moon Milk by Gina Fontana
    • 7-Day Vegan Challenge Recipe eBook
  • About
    • My Health Story
    • Work With Me
    • Contact
  • For Food Bloggers
    • Food Blogger Resources

      Foodtography School Review

      November 11, 2021

      Food Blogger Resources

      Food Photography Equipment

      December 16, 2020

    • Foodtography School Review
    • Food Photography Equipment
  • Cooking Course
  • My Shop
  • Search…
[slide-anything id="6097"]
Dessert

Chocolate Peppermint Cake with Pitaya Peppermint Frosting

by Gina Fontana December 5, 2019
written by Gina Fontana December 5, 2019
Jump to Recipe

A deliciously moist and fluffy gluten-free, vegan chocolate cake with a peppermint buttercream frosting garnished with sugared cranberries and rosemary sprigs. A holiday classic with a touch of pink!

holiday dessert recipes

This is a sponsored post written by me on behalf of Suncore Foods. The opinions and text are all mine. The product mentioned in this post was sent to me as a gift to use in this recipe, thank you so much Suncore Foods!

gluten free dessert recipes

When I think of peppermint holiday desserts, red or green come to mind, like fresh mint sprigs. But I decided to go pink this holiday season and frost my Chocolate Peppermint Cake with the most beautiful shade of pink! The frosting is naturally colored by the way, with Pitaya Powder from Suncore Foods!

Suncore Foods
pitaya powder

It’s not uncommon for me to talk on my blog about how challenging gluten-free vegan baking can be. There have been countless fails, lots of dollars straight to the garbage (which, ya’ll know it drives me nuts to throw food away!), and plenty of opportunities for me to give up baking all together. BUT, I am also not a quitter- maybe I drive myself a little crazy trying to perfect a recipe or get something just right- but I’m sure glad I stuck with it because this gluten-free, vegan Chocolate Peppermint Cake with Pitaya Peppermint Frosting is totally worth all those baking fails.

Vittle Club
vegan dessert recipes

Other than the cake turning out so moist and delicious, with just the right amount of chocolatey goodness to compliment the peppermint, I had a blast decorating this cake! Holiday cake decorating is my fav, which is really good since I may have to make holiday cakes the rest of my life, with my son being born on Christmas Eve!

gluten free cake

So what makes this cake so moist and delicious? Aquafaba. Aquafaba is a dear friend of mine. I think that was the aha moment, when everything in my gluten-free, vegan baking world clicked. If you’re not familiar with aquafaba, it’s the liquid in a can of chickpeas. Weird, huh?! Pure geniusness if you ask me. It whips up like egg whites and makes your vegan baked goodies so moist, like eggs would! I rave about it often, I’m sure you’ve noticed I’m totally crushing on aquafaba lol.

chocolate cake

So for the Chocolate Peppermint Cake I used gluten-free flour, baking soda, baking powder, salt, vanilla, peppermint, aquafaba, coconut milk, cocoa powder, chocolate chunks, agave, and date syrup! Completely naturally sweetened! Because I use organic powdered sugar for my Pitaya Peppermint Frosting, I wanted to keep the cake naturally sweetened, because we all know (no matter how much we want to deny it) that too much sugar will put your straight on the naughty list. Haha.

cake photography

The Pitaya Peppermint Frosting is a buttercream frosting made with vegan/plant butter, peppermint, organic powdered sugar, and Pink Pitaya Supercolor Powder from Suncore Foods. Now, I feel like the holidays are all about balance, right? It’s ok to indulge a bit, but I sure do feel better when I can sneak some superfoods in my baked goods like I did with this Chocolate Peppermint Cake with Pitaya Peppermint Frosting recipe. Not only does the pink pitaya powder give it this gorgeous pink hue naturally, but it also packs some pretty great health benefits and nutrients too!

holiday dessert recipes

Pitaya, also known as Dragon Fruit, is a rather exotic fruit. If you’ve ever had them, they are just as gorgeous in their whole form as their powdered form. Dragon fruit has rightfully earned its exotic reputation for vivid color, but the fruit is as healthy as it is beautiful. They contain many antioxidants, antibacterial, and nutritional properties help smooth the digestive process and boost the immune system and metabolism. This super fruit is loaded with Vitamin C, several types of Vitamin B, protein, fiber and essential polyunsaturated fatty acids.*

Suncore Foods pitaya powder
cake recipes

See? Healthy cake. LOL. No, but in all seriousness, this cake is definitely a lot healthier than alternative options you might be exposed to this holiday season but I promise, just as delicious. OH! And in case you were wondering, pitaya powder is pretty much flavorless, so it won’t add any weird flavor to your icing. It’s actually my favorite superfood powder to work with, and because duh, it’s pink! 😉

chocolate cake recipes

I chose to decorate my Chocolate Peppermint Cake with Pitaya Peppermint Frosting with sugared cranberries and rosemary and peppermint candies, but that’s completely optional. The cake and frosting taste great without all the embellishments, but if you’re up for some snazzy holiday decorating, have at it!

healthy dessert recipes

So head on over to Suncore Foods or to my Amazon Shop to get your Pink Pitaya Supercolor Powder, and get baking! Be sure to tag me on  Instagram or Facebook if you make this delicious cake recipe! Also, check out my Pitaya Poached Pears, Galaxy Meringue Pops, or Pink Pitaya Moon Milk recipes for more ways to use your Pink Pitaya Powder! Wishing you a pretty pink holiday season!

Continue to Content
healthy dessert recipes

Chocolate Peppermint Cake with Pitaya Peppermint Frosting

Yield: 6-8 people
Prep Time: 15 minutes
Cook Time: 35 minutes
Additional Time: 1 hour
Total Time: 1 hour 50 minutes

A deliciously moist and fluffy gluten-free, vegan chocolate cake with a peppermint buttercream frosting garnished with sugared cranberries and rosemary sprigs. A holiday classic with a touch of pink!

Ingredients

Chocolate Peppermint Cake

  • 2 cups gluten-free 1:1 baking flour
  • 1 teaspoon baking soda
  • 2 teaspoons baking powder
  • 1/2 teaspoon salt
  • 1 cup date sugar
  • 1/4 cup unsweetened cocoa powder
  • 1/4 cup agave syrup (or maple syrup)
  • 1 teaspoon pure vanilla extract
  • 1/2 teaspoon pure peppermint extract
  • 1 can aquafaba (the liquid in a can of chickpeas)
  • 2 teaspoons cream of tartar (whipped with the chickpea brine)
  • 1 can coconut milk
  • 1/2 cup dark chocolate chunks/chips

Pitaya Peppermint Frosting

  • 1 cup vegan/plant butter
  • 4 cups organic powdered sugar
  • 1 teaspoon pure peppermint extract
  • 2 tablespoons Suncore Foods Pink Pitaya Supercolor Powder

Decorations (Sugared Cranberries/Rosemary Sprigs)-optional

  • 1 cup fresh organic cranberries
  • fresh rosemary (about 4-6 sprigs)
  • 1/2 cup organic cane sugar
  • 1/2 cup water
  • 1-2 cups sparking sugar

Instructions

Sugared Cranberries + Rosemary

  1. If you're decorating your cake with sugared cranberries and rosemary, make these first.
  2. Place ½ cup granulated sugar and ½ cup water in a small saucepan.
  3. Stir together while heating over medium-high heat.
  4. Continue to stir occasionally until sugar dissolves and mixture begins to boil.
  5. Remove from heat and add the cranberries (you may have to do this in a couple different batches)
  6. Allow the cranberries to sit for 4-5 minutes in the sugar water mixture.
  7. Using a slotted spoon, remove cranberries from the saucepan and place on parchment paper for 10 minutes (making sure they aren't touching).
  8. Repeat with other cranberries and the rosemary sprigs.
  9. Place your sparking sugar in a medium bowl.
  10. Add a few cranberries at a time and use fingers or small spoon to gently roll in the sugar to coat completely on all sides (be sure your cranberries don't stick to eachother).
  11. Remove and place on a parchment lined baking rack to dry.
  12. Repeat with all cranberries and rosemary sprigs.
  13. Let them dry at room temperature for one hour. Store leftovers in the fridge.

Chocolate Peppermint Cake

  1. Preaheat your oven to 350 degrees F.
  2. Whisk together all dry ingredients in a medium bowl (except for dark chocolate chunks/chips.
  3. In your KitchenAid mixer (or alternatively you can use a hand beater with a large bowl), beat your aquafaba (the liquid from a can of chickpeas) on high until it starts to froth up. Add the cream of tartar as it starts to thicken. It's done when stiff peaks form and it resembles whipped egg whites.
  4. Add the liquid ingredients to the bowl with the whipped aquafaba (this will cause it to deflate).
  5. Finally add in the dry cake mix to the bowl and blend until a nice smooth batter forms.
  6. Fold in the chocolate chunks/chips.
  7. Spray 2 6-inch cake pans with coconut oil and place them on a large baking sheet (makes it easier to take them out of the oven).
  8. Fill each pan equally with the cake batter and bake for 25-35 minutes, until a toothpick inserted in the middle comes out clean.
  9. Move the cakes to a cooling rack and cool for about an hour before frosting

Pitaya Peppermint Frosting

  1. In your KitchenAid Mixer (or bowl with hand blender) beat the butter, vanilla, and peppermint until its smooth.
  2. Slowly add in your powdered sugar, 1/2 cup at a time and continute beating while you do so.
  3. Finally, add the Pitaya Powder.


Frosting and Decorating

  1. When your cakes are cool, place one cake onto a cake platter or flat dish. NOTE: you may need to slice the top off the bottom cake to make sure the other cake will sit flat on top of it.
  2. Add a generous amount of frosting on the top of that cake.
  3. Add the other cake on top of it, making sure it's stable.
  4. Spread the remaining frosting over the whole cake (you may have a little leftover frosting).
  5. Decorate with sugared cranberries and rosemary sprigs (and peppermint candies if desired).





Notes

* best if eaten within a day or two

Did you make this recipe?

Tag @healthylittlevittles on Instagram and hashtag it #healthylittlevittles

© Gina Fontana
Cuisine: American / Category: Dessert

CLICK BELOW TO PIN!

* nutritional information provided by Suncore Foods

201 shares
  • Facebook
  • Email
cakechocolatedessertegg freegluten freenaturally sweetenedpinkpitayasweetsvegan
Gina Fontana

previous post
Cookie Dough Stuffed Dates
next post
Superfood Puppy Chow

You may also like

Vegan Cast Iron S’mores Dip

May 26, 2022

Strawberries and Cream Quinoa Cookies (No-Bake!)

May 10, 2022

Lavender Vanilla Oatmeal Shortbread Cookies

May 1, 2022

Leave a Comment Cancel Reply

Save my name, email, and website in this browser for the next time I comment.

This site uses Akismet to reduce spam. Learn how your comment data is processed.

Search

HEALTHY LITTLE VITTLES is a food blog created by certified health coach and published author, Gina Fontana, that focuses on gluten-free + vegan + plant-based recipes. Here you'll find simple, flavorful meals, many made in 30 minutes or less! All eaters are welcome, there is a little something here for everyone!

Cover image of a cupcake with strawberry frosting: The Beginners Guide to Gluten-Free, Vegan Baking by Gina Fontana
LEARN MORE
Purchase

Turn Your Food Photography into a Thriving Business!

a collage of my food images with the code gina for 15% off

Click to learn more and enroll in Foodtography School today! Get 15% off by using code gina

healthylittlevittles

Gina | Healthy Little Vittles
A delicious THAI CHOPPED SALAD using green and pur A delicious THAI CHOPPED SALAD using green and purple cabbage, kale, broccoli, carrots, green onion, cilantro, mandarine oranges, and sliced almonds tossed in a simple Thai almond butter dressing for a delicious plant-based meal or side dish for this weekend!
.
SHOP 👉🏻 Thai Chopped Salad 
RECIPE:
2 cups chopped red cabbage
2 cups chopped green cabbage
4 cups chopped kale
2 cups chopped broccoli
1/2 cup chopped cilantro
1 cup sliced carrots (pre-sliced)
1 cup chopped green onion
2 cups sliced cucumbers
1.5 cups canned mandarine oranges, drained
1/2 cup sliced almonds

Thai Almond Butter Dressing
3/4 cup almond butter
1/2 cup water
1/4 cup liquid aminos/gluten-free soy sauce/coconut aminos (for soy free)
1 teaspoon minced garlic
2 tablespoons rice wine vinegar
2 tablespoons maple syrup
1 tablespoon lime juice

Instructions
Wash all of your produce, then chop the produce using your desired Calphalon Precision Knife. Place the measured produce into a large bowl. Toss everything together, except for the sliced almonds and divide between bowls.
Make the dressing by blending all of the dressing ingredients together and pour over each individual salad as desired. Garnish with sliced almonds and enjoy!

https://www.healthylittlevittles.com/thai-chopped-salad/
Bring this summertime s’mores treat inside to en Bring this summertime s’mores treat inside to enjoy a favorite campfire classic flavor! This simple VEGAN CAST IRON S’MORES DIP is made with a layer of melted dark chocolate swirled with sunflower seed butter and homemade vegan marshmallow fluff served with gluten-free graham crackers or fresh fruit! This dessert dip is such a crowd pleaser and perfect to share with your loved ones!
.
#ad I am excited to be partnering with @Calphalon today to bring you a delicious s’mores recipe modified to be gluten-free and vegan so everyone can enjoy them together this Father’s Day! 
.
Making this delectable dessert recipe as a dip allows it to be a shareable, fuss-free, less messy way to enjoy s'mores! By using the Calphalon™ Cast Iron 12-Inch Round Skillet it retains heat so this dip stays warm while serving. Constructed entirely of cast iron, this durable pan is designed to heat evenly and steadily and allows you to be able to use the broiler for quicker prep time and just a touch of that charred campfire flavor for a real s'mores experience ;) Not to mention, with oversized handles, lifting the pan to transfer to the oven or table is easy.
.
You only need 6 ingredients (yes! It’s true!) to make this absolutely delicious dip! Head to the blog to read more and snag the recipe while you’re there! 
.
🎉 USE CODE GINA25 for 25% OFF sitewide when you shop on Calphalon.com!!! 🎉
#CalphalonKitchenClub #Calphalon #CalphalonPartner
Bring this delicious dairy-free, vegan, gluten-fre Bring this delicious dairy-free, vegan, gluten-free side dish to your next cookout! This SMOKED DILL PAPRIKA POTATO SALAD puts a smokey spin on traditional potato salad and is made healthier by using avocado in the creamy dressing!
SHOP 👉🏻 Smoked Paprika Dill Potato Salad 
.
INGREDIENTS 
3 lbs yellow/yukon gold potatoes
1 heaping cup celery, sliced
1/4 cup fresh dill, chopped
1/3 cup vegan mayo
1 avocado
1/2 teaspoon smoked paprika
1 teaspoon dijon mustard
1/2 lemon, juiced
2 teaspoons salt, plus more to taste
1/2 teaspoon pepper, plus more to taste

INSTRUCTIONS 
Wash the potatoes and place them into a large pot. Cover the potatoes with water, making sure all of the potatoes are fully covered and boil on high for about 15-20 minutes, until the are soft when you poke them with a fork.
Meanwhile, wash and slice the celery, and chop the dill.
Drain the potatoes and rinse with cold water. Let them cool, then slice them into small chunks. You can choose to remove the skin or leave it on, I removed it. Place the potato wedges in a large bowl.
Place the vegan mayo, avocado, paprika, dijon, lemon juice, salt, and pepper in a food processor/blender and blend until smooth. Pour the creamy dressing over the potatoes, add the celery and dill and stir to coat all of the potatoes well. You can choose to mash some of the potatoes too if you like your potato salad more "mushy".
Cover and place in the fridge for at least an hour before serving. You may chill overnight. Add more salt and pepper to taste before serving if desired.
.
https://www.healthylittlevittles.com/smoked-paprika-dill-potato-salad/
A deliciously easy Italian cookie recipe made glut A deliciously easy Italian cookie recipe made gluten-free and vegan! These LEMON VANILLA BISCOTTI are bursting with flavor, are really easy to make 🍋 They are the perfect lemon-flavored dessert!
.
SHOP 👉🏻 Lemon Vanilla Biscotti
RECIPE in bio @healthylittlevittles
.
https://www.healthylittlevittles.com/lemon-vanilla-biscotti/
This GREEN BEAN POTATO SALAD features fresh green This GREEN BEAN POTATO SALAD features fresh green beans, potatoes, butter beans, peas, and cucumber tossed in a light apple cider vinegar and olive oil dressing, then garnished with mint, toasted almonds, and chia seeds for a refreshing side dish worthy to have a spot at the table of your next cookout! 💚💜
.
SHOP 👉🏻 Green Bean Potato Salad 
Full recipe on the blog, clickable link in bio @healthylittlevittles
.
https://www.healthylittlevittles.com/green-bean-potato-salad/
It’s gonna be a hot one today 🥵 putting some It’s gonna be a hot one today 🥵 putting some of these PINEAPPLE COCONUT AÇAÍ CHIA ICE POPS in the freezer this morning for a healthy, fun cool down later ☀️💜
.
Recipe on the blog, clickable link in bio @healthylittlevittles
.
https://www.healthylittlevittles.com/pineapple-coconut-acai-chia-ice-pops/
A couple of weeks ago my Instagram shop went live! A couple of weeks ago my Instagram shop went live! 🎉 You can now shop my recipes right from Instagram and have the groceries delivered right to your doorstep via DoorDash! How cool is this?! I'm super excited about it and I hope you are too 😊 This will hopefully make meal prep + planning easier for you! ❤️
.
Also in the works is a shoppable meal plan with a recipe ebook included! You will be able to purchase all the ingredients needed to make a week's worth of meals and have everything already planned out for you. Stay tuned for that in the near future!
.
I will also be adding this shop feature on my
blog very soon too, keep checking back! I'll be sure to make the announcement when it's ready.
.
This is a new service and the @eatwithjupiter team is hard at work to provide customers with the best experience. They are adding more stores, products and features to make this shopping experience simple and convenient. Would love to hear your feedback!
.
As always, THANK YOU for your support! Your continued engagement and following has allowed me to be able to grow my business to include fun new services such as this! 🙏🏻 CHECK IT OUT and let me know what you think! So far I think you are all loving it! 🥰 Have a great day everyone! ☀️ 
.
https://www.instagram.com/healthylittlevittles/shop
Warmer days + cooler evenings makes a perfect comb Warmer days + cooler evenings makes a perfect combination for a light + nourishing soup! 🧡
.
SHOP 👉🏻 Roasted Butternut Squash Carrot Soup 
.
https://www.healthylittlevittles.com/roasted-butternut-squash-carrot-soup/
See more... Follow on Instagram
  • Facebook
  • Twitter
  • Instagram
  • Pinterest
  • Youtube
  • Bloglovin
  • Tiktok

AFFILIATE DISCLOSURE
My blog contains affiliate links, which means I receive a percentage of the sale if you use the link to featured products to make your purchase. This does not change the price of the product. This income directly offsets the cost of web hosting and maintenance so I greatly appreciate your support. Gina is a also a participant in the Amazon Services LLC Associates Program, an affiliate advertising program designed to provide a means for sites to earn fees by advertising and linking to amazon.com

COPYRIGHT © 2019 REGINA ANN FONTANA, LLC
Privacy Policy


Back To Top
Healthy Little Vittles
  • Recipes
    • All books and ebooks Breakfast Dessert Drinks Grain-Free Homemade Condiments Lunch & Dinner No-Bake Desserts Recipe Roundups Salads Side Dishes Smoothies + Smoothie Bowls Snacks & Appetizers Soups
      Dessert

      Vegan Cast Iron S’mores Dip

      May 26, 2022

      Breakfast

      Blueberry Spinach Spirulina Smoothie

      May 20, 2022

      Dessert

      Strawberries and Cream Quinoa Cookies (No-Bake!)

      May 10, 2022

      Breakfast

      Gluten-Free Vegan French Crepes

      May 2, 2022

      Dessert

      Lavender Vanilla Oatmeal Shortbread Cookies

      May 1, 2022

      Breakfast

      Grain-Free Banana Bread Donuts

      April 24, 2022

      Dessert

      Vegan Lemon Bars with Graham Granola Crust

      April 18, 2022

      Dessert

      Chocolate Avocado Pudding Dirt Cups

      April 15, 2022

      books and ebooks

      The Beginner’s Guide to Gluten-Free Vegan Baking

      September 16, 2021

      books and ebooks

      7-Day Vegan Challenge eBook

      December 28, 2020

      books and ebooks

      Moon Milk by Gina Fontana

      May 11, 2019

      Breakfast

      Blueberry Spinach Spirulina Smoothie

      May 20, 2022

      Breakfast

      Gluten-Free Vegan French Crepes

      May 2, 2022

      Breakfast

      Grain-Free Banana Bread Donuts

      April 24, 2022

      Breakfast

      Strawberries and Cream Breakfast Quinoa

      April 7, 2022

      Breakfast

      Blueberry Overnight Quinoa

      March 6, 2022

      Breakfast

      Anti-Inflammatory Vegan Green Smoothie

      February 25, 2022

      Breakfast

      Four Seed Homemade Vegan Protein Bars (no-bake)

      January 27, 2022

      Breakfast

      Grain-Free Cinnamon Sugar Donuts

      January 10, 2022

      Dessert

      Vegan Cast Iron S’mores Dip

      May 26, 2022

      Dessert

      Strawberries and Cream Quinoa Cookies (No-Bake!)

      May 10, 2022

      Dessert

      Lavender Vanilla Oatmeal Shortbread Cookies

      May 1, 2022

      Dessert

      Vegan Lemon Bars with Graham Granola Crust

      April 18, 2022

      Dessert

      Chocolate Avocado Pudding Dirt Cups

      April 15, 2022

      Dessert

      Grain-Free Lemon Cupcakes (Vegan)

      April 3, 2022

      Dessert

      Crispy Quinoa Cacao Cookies (No-Bake!)

      March 28, 2022

      Dessert

      Quinoa Chocolate Chip Cookies

      March 2, 2022

      Drinks

      Purple Passion Blender Juice

      June 8, 2020

      Drinks

      Orange Sunrise Blender Juice

      May 3, 2020

      Drinks

      Blender Beet Juice

      April 21, 2020

      Drinks

      Blender Green Juice

      April 5, 2020

      Drinks

      Iced Matcha Dalgona Latte

      April 3, 2020

      Drinks

      Matcha Latte

      February 26, 2020

      Drinks

      Moon Milk by Gina Fontana

      May 11, 2019

      Drinks

      Vegan Italian Cream Sodas

      February 16, 2019

      Grain-Free

      Grain-Free Banana Bread Donuts

      April 24, 2022

      Grain-Free

      Quinoa Chocolate Chip Cookies

      March 2, 2022

      Grain-Free

      Grain-Free Vanilla Cupcakes with Blackberry Frosting

      February 6, 2022

      Grain-Free

      Grain-Free Cinnamon Sugar Donuts

      January 10, 2022

      Grain-Free

      Grain-Free Marbled Snowflake Sugar Cookies

      December 22, 2021

      Grain-Free

      Grain-Free Vegan Cinnamon Streusel Muffins

      August 15, 2021

      Grain-Free

      Vegan Grain-Free S’mores Brownies

      June 18, 2021

      Grain-Free

      Grain-Free Cherry Pop Tarts

      June 8, 2021

      Homemade Condiments

      How to Make Vegan Buttermilk

      April 11, 2022

      Homemade Condiments

      Easy Vegan Lemon Curd (Refined Sugar-Free)

      March 24, 2022

      Homemade Condiments

      Pumpkin BBQ Sauce

      December 9, 2021

      Homemade Condiments

      Golden Delicious Cinnamon Applesauce

      November 26, 2021

      Homemade Condiments

      Vegan Nacho Cheese Sauce (Nut-Free!)

      October 18, 2021

      Homemade Condiments

      Homemade Vegan Caramel Sauce

      September 27, 2021

      Homemade Condiments

      Naturally Sweetened Instant Pot Apple Butter

      October 1, 2020

      Homemade Condiments

      Cinnamon Sugar Cookie Cereal

      July 6, 2020

      Lunch & Dinner

      Creamy Alfredo Style Mushroom Pasta

      February 20, 2022

      Lunch & Dinner

      Easy Weeknight Mushroom Pho

      February 10, 2022

      Lunch & Dinner

      Maple Curry Garlic Ramen Noodle Bowls

      January 31, 2022

      Lunch & Dinner

      Sesame Kale Spring Rolls

      January 16, 2022

      Lunch & Dinner

      Vegan Latkes

      November 29, 2021

      Lunch & Dinner

      Roasted Broccoli Potato Tahini Soup

      October 29, 2021

      Lunch & Dinner

      Roasted Butternut Squash Carrot Soup

      October 14, 2021

      Lunch & Dinner

      Vegan Gluten-Free Chicken and Dumplings

      October 4, 2021

      No-Bake Desserts

      Strawberries and Cream Quinoa Cookies (No-Bake!)

      May 10, 2022

      No-Bake Desserts

      Crispy Quinoa Cacao Cookies (No-Bake!)

      March 28, 2022

      No-Bake Desserts

      Four Seed Homemade Vegan Protein Bars (no-bake)

      January 27, 2022

      No-Bake Desserts

      No-Bake Cherry Cake Pops

      July 19, 2021

      No-Bake Desserts

      No-Bake Vegan Cheesecake Ghosts

      October 22, 2020

      No-Bake Desserts

      Pumpkin Spice Chocolate Fudge

      September 7, 2020

      No-Bake Desserts

      No-Bake Peanut Butter Cup Bars

      May 26, 2020

      No-Bake Desserts

      Raw Chocolate Chip Cookie Dough Brownie Rolls

      February 24, 2020

      Recipe Roundups

      Vegan Thanksgiving Recipe Round-Up

      November 17, 2021

      Recipe Roundups

      25 Plant-Based, Gluten-Free, Vegan Recipe Roundup

      March 19, 2020

      Salads

      Thai Chopped Salad

      June 8, 2021

      Salads

      Watermelon Roasted Peach and Cobbed Corn Arugula Salad

      September 11, 2020

      Salads

      Green Bean Potato Salad

      August 17, 2020

      Salads

      Bourbon Cherry Kale Salad with Almond Oat Granola

      July 27, 2020

      Salads

      Creamy Grilled Romaine Salad

      March 19, 2020

      Salads

      Walnut Pear Sweet Potato Mason Jar Salads

      August 9, 2019

      Salads

      Spring Detox Mason Jar Salads

      April 6, 2019

      Salads

      Kaniwa Pear Salad

      March 10, 2019

      Side Dishes

      Vegan Latkes

      November 29, 2021

      Side Dishes

      Golden Delicious Cinnamon Applesauce

      November 26, 2021

      Side Dishes

      Gluten-Free Vegan Skillet Buttermilk Biscuits

      November 18, 2021

      Side Dishes

      Smoked Paprika Dill Potato Salad

      September 2, 2021

      Side Dishes

      Copycat True Food Kitchen Tahini Harissa Cauliflower

      August 23, 2021

      Side Dishes

      Gluten-Free, Vegan Green Bean Casserole

      November 10, 2020

      Side Dishes

      Browned Butter Bourbon Skillet Sweet Potatoes

      October 29, 2020

      Side Dishes

      Green Bean Potato Salad

      August 17, 2020

      Smoothies + Smoothie Bowls

      Blueberry Spinach Spirulina Smoothie

      May 20, 2022

      Smoothies + Smoothie Bowls

      Anti-Inflammatory Vegan Green Smoothie

      February 25, 2022

      Smoothies + Smoothie Bowls

      Cookie Monster Smoothie Bowl

      April 3, 2021

      Smoothies + Smoothie Bowls

      Vegan Pumpkin Pie Smoothie Bowl

      October 12, 2020

      Smoothies + Smoothie Bowls

      Peanut Butter Banana Dalgona Smoothie

      April 15, 2020

      Smoothies + Smoothie Bowls

      Strawberry Banana Sundae Smoothie Bowls

      January 25, 2019

      Snacks & Appetizers

      Crispy Quinoa Cacao Cookies (No-Bake!)

      March 28, 2022

      Snacks & Appetizers

      Baked Leftover Mashed Potato Croquettes

      February 15, 2022

      Snacks & Appetizers

      Four Seed Homemade Vegan Protein Bars (no-bake)

      January 27, 2022

      Snacks & Appetizers

      Pumpkin BBQ Sauce

      December 9, 2021

      Snacks & Appetizers

      Golden Delicious Cinnamon Applesauce

      November 26, 2021

      Snacks & Appetizers

      Vegan Nacho Cheese Sauce (Nut-Free!)

      October 18, 2021

      Snacks & Appetizers

      Strawberries and Cream Granola Bites

      May 10, 2021

      Snacks & Appetizers

      Carrot Cake Granola Bites

      March 29, 2021

      Soups

      Easy Weeknight Mushroom Pho

      February 10, 2022

      Soups

      Roasted Cauliflower Soup

      January 4, 2022

      Soups

      Roasted Broccoli Potato Tahini Soup

      October 29, 2021

      Soups

      Roasted Butternut Squash Carrot Soup

      October 14, 2021

      Soups

      Roasted Creamy Tomato Carrot Soup

      September 9, 2021

      Soups

      One-Pot Smoked Paprika Corn Chowder

      September 19, 2020

      Soups

      Spinach Artichoke Gnocchi Soup

      January 17, 2019

      Soups

      Curried Butternut Squash + Lentil Soup

      November 26, 2018

  • My Books
    • books and ebooks

      The Beginner’s Guide to Gluten-Free Vegan Baking

      September 16, 2021

      books and ebooks

      7-Day Vegan Challenge eBook

      December 28, 2020

      books and ebooks

      Moon Milk by Gina Fontana

      May 11, 2019

    • The Beginner’s Guide to Gluten-Free Vegan Baking
    • Moon Milk by Gina Fontana
    • 7-Day Vegan Challenge Recipe eBook
  • About
    • My Health Story
    • Work With Me
    • Contact
  • For Food Bloggers
    • Food Blogger Resources

      Foodtography School Review

      November 11, 2021

      Food Blogger Resources

      Food Photography Equipment

      December 16, 2020

    • Foodtography School Review
    • Food Photography Equipment
  • Cooking Course
  • My Shop
  • Search…