Healthy Little Vittles
  • Recipes
    • All books and ebooks Breakfast Dessert Drinks Lunch & Dinner Make Your Own… Recipe Roundups Salads Side Dishes Snacks & Appetizers Soups
      Snacks & Appetizers

      Beet Hummus Hash Brown Toast

      January 7, 2021

      books and ebooks

      7-Day Vegan Challenge eBook

      December 28, 2020

      Snacks & Appetizers

      Candied Amaretto Trail Mix

      December 21, 2020

      Dessert

      Browned Butter Caramel Popcorn

      December 14, 2020

      Dessert

      Vegan Gingerbread Crème Brûlée

      December 5, 2020

      Lunch & Dinner

      Butternut Squash Spinach Pasta

      November 30, 2020

      Dessert

      Hot Cocoa Whoopie Pies

      November 22, 2020

      Dessert

      Gingerbread Cream Sandwich Cookies

      November 13, 2020

      books and ebooks

      7-Day Vegan Challenge eBook

      December 28, 2020

      Breakfast

      Vegan Pumpkin Pie Smoothie Bowl

      October 12, 2020

      Breakfast

      Naturally Sweetened Instant Pot Apple Butter

      October 1, 2020

      Breakfast

      Vegan Acorn Squash Breakfast Bowls

      September 23, 2020

      Breakfast

      Hash Brown Avocado Toast

      July 29, 2020

      Breakfast

      Cinnamon Sugar Cookie Cereal

      July 6, 2020

      Breakfast

      Roasted Strawberry Ricotta Toast

      June 18, 2020

      Breakfast

      Mini Everything Bagels

      June 15, 2020

      Breakfast

      Purple Passion Blender Juice

      June 8, 2020

      Dessert

      Browned Butter Caramel Popcorn

      December 14, 2020

      Dessert

      Vegan Gingerbread Crème Brûlée

      December 5, 2020

      Dessert

      Hot Cocoa Whoopie Pies

      November 22, 2020

      Dessert

      Gingerbread Cream Sandwich Cookies

      November 13, 2020

      Dessert

      Soft Pumpkin Sugar Cookies with Bourbon Cinnamon Frosting

      October 26, 2020

      Dessert

      No-Bake Vegan Cheesecake Ghosts

      October 22, 2020

      Dessert

      Gluten-Free Apple Butter Whoopie Pies with Bourbon Cinnamon…

      October 17, 2020

      Dessert

      Caramel Apple Crumb Bars

      October 14, 2020

      Drinks

      Purple Passion Blender Juice

      June 8, 2020

      Drinks

      Orange Sunrise Blender Juice

      May 3, 2020

      Drinks

      Blender Beet Juice

      April 21, 2020

      Drinks

      Peanut Butter Banana Dalgona Smoothie

      April 15, 2020

      Drinks

      Blender Green Juice

      April 5, 2020

      Drinks

      Iced Matcha Dalgona Latte

      April 3, 2020

      Drinks

      Matcha Latte

      February 26, 2020

      Drinks

      Vegan Italian Cream Sodas

      February 16, 2019

      Lunch & Dinner

      Butternut Squash Spinach Pasta

      November 30, 2020

      Lunch & Dinner

      Stovetop Vegan Mac and Cheese

      November 5, 2020

      Lunch & Dinner

      Vegan Gluten-Free Pumpkin Mac and Cheese

      September 28, 2020

      Lunch & Dinner

      Baked Potato Gnocchi

      September 26, 2020

      Lunch & Dinner

      One-Pot Creamy Vegan Taco Pasta

      August 31, 2020

      Lunch & Dinner

      Bourbon Cherry Kale Salad with Almond Oat Granola

      July 27, 2020

      Lunch & Dinner

      Tomato Ricotta Galette

      July 20, 2020

      Lunch & Dinner

      Asparagus Shallot Tart

      June 23, 2020

      Make Your Own…

      Naturally Sweetened Instant Pot Apple Butter

      October 1, 2020

      Make Your Own…

      Cinnamon Sugar Cookie Cereal

      July 6, 2020

      Make Your Own…

      Vegan Marshmallows

      June 29, 2020

      Make Your Own…

      Mini Everything Bagels

      June 15, 2020

      Make Your Own…

      Homemade Vegan Ricotta Cheese

      June 11, 2020

      Make Your Own…

      Purple Passion Blender Juice

      June 8, 2020

      Make Your Own…

      Gluten-Free Vegan Naan

      June 2, 2020

      Make Your Own…

      Vegan Hollandaise Sauce

      May 29, 2020

      Recipe Roundups

      Vegan Thanksgiving Recipe Round-Up

      November 6, 2020

      Recipe Roundups

      25 Plant-Based, Gluten-Free, Vegan Recipe Roundup

      March 19, 2020

      Salads

      Watermelon Roasted Peach and Cobbed Corn Arugula Salad

      September 11, 2020

      Salads

      Green Bean Potato Salad

      August 17, 2020

      Salads

      Bourbon Cherry Kale Salad with Almond Oat Granola

      July 27, 2020

      Salads

      Creamy Grilled Romaine Salad

      March 19, 2020

      Salads

      Walnut Pear Sweet Potato Mason Jar Salads

      August 9, 2019

      Salads

      Spring Detox Mason Jar Salads

      April 6, 2019

      Salads

      Kaniwa Pear Salad

      March 10, 2019

      Salads

      Brussels + Roasted Cauliflower Grapefruit Salad

      November 1, 2018

      Side Dishes

      Gluten-Free, Vegan Green Bean Casserole

      November 10, 2020

      Side Dishes

      Browned Butter Bourbon Skillet Sweet Potatoes

      October 29, 2020

      Side Dishes

      Green Bean Potato Salad

      August 17, 2020

      Side Dishes

      Maple Sriracha Cauliflower

      July 14, 2020

      Side Dishes

      Ginger Dill Spring Peas

      April 9, 2020

      Side Dishes

      Creamy Dirty Mashed Potatoes

      March 29, 2020

      Side Dishes

      Creamy Grilled Romaine Salad

      March 19, 2020

      Side Dishes

      Cornbread Stuffing

      November 23, 2019

      Snacks & Appetizers

      Beet Hummus Hash Brown Toast

      January 7, 2021

      Snacks & Appetizers

      Candied Amaretto Trail Mix

      December 21, 2020

      Snacks & Appetizers

      Browned Butter Caramel Popcorn

      December 14, 2020

      Snacks & Appetizers

      Hash Brown Avocado Toast

      July 29, 2020

      Snacks & Appetizers

      Cinnamon Sugar Cookie Cereal

      July 6, 2020

      Snacks & Appetizers

      Vegan Abstract Yogurt Popsicles

      July 2, 2020

      Snacks & Appetizers

      Blueberry Guacamole

      May 4, 2020

      Snacks & Appetizers

      Salted Cacao Caramel

      April 17, 2020

      Soups

      One-Pot Smoked Paprika Corn Chowder

      September 19, 2020

      Soups

      Spinach Artichoke Gnocchi Soup

      January 17, 2019

      Soups

      Curried Butternut Squash + Lentil Soup

      November 26, 2018

      Soups

      Slow Cooker Broccoli “Cheese” Soup

      October 3, 2018

      Soups

      Slow Cooker Lasagna Soup

      September 12, 2018

      Soups

      Baby Bok Choy + Shiitake Red Curry Soup

      May 4, 2018

      Soups

      Creamy Pumpkin Soup with Crispy Chickpeas + Pomegranate…

      October 7, 2017

      Soups

      Miso Tahini Ramen Noodle Bowls

      September 30, 2017

  • My Books
    • Moon Milk
    • 7-Day Vegan Challenge Recipe eBook
  • About
    • Work With Me
    • Contact
    • My Health Story
  • Food Photography
  • Shop
  • Search…
Healthy Little Vittles

Gluten-Free, Vegan, Plant-Based Recipes

  • Recipes
    • All books and ebooks Breakfast Dessert Drinks Lunch & Dinner Make Your Own… Recipe Roundups Salads Side Dishes Snacks & Appetizers Soups
      Snacks & Appetizers

      Beet Hummus Hash Brown Toast

      January 7, 2021

      books and ebooks

      7-Day Vegan Challenge eBook

      December 28, 2020

      Snacks & Appetizers

      Candied Amaretto Trail Mix

      December 21, 2020

      Dessert

      Browned Butter Caramel Popcorn

      December 14, 2020

      Dessert

      Vegan Gingerbread Crème Brûlée

      December 5, 2020

      Lunch & Dinner

      Butternut Squash Spinach Pasta

      November 30, 2020

      Dessert

      Hot Cocoa Whoopie Pies

      November 22, 2020

      Dessert

      Gingerbread Cream Sandwich Cookies

      November 13, 2020

      books and ebooks

      7-Day Vegan Challenge eBook

      December 28, 2020

      Breakfast

      Vegan Pumpkin Pie Smoothie Bowl

      October 12, 2020

      Breakfast

      Naturally Sweetened Instant Pot Apple Butter

      October 1, 2020

      Breakfast

      Vegan Acorn Squash Breakfast Bowls

      September 23, 2020

      Breakfast

      Hash Brown Avocado Toast

      July 29, 2020

      Breakfast

      Cinnamon Sugar Cookie Cereal

      July 6, 2020

      Breakfast

      Roasted Strawberry Ricotta Toast

      June 18, 2020

      Breakfast

      Mini Everything Bagels

      June 15, 2020

      Breakfast

      Purple Passion Blender Juice

      June 8, 2020

      Dessert

      Browned Butter Caramel Popcorn

      December 14, 2020

      Dessert

      Vegan Gingerbread Crème Brûlée

      December 5, 2020

      Dessert

      Hot Cocoa Whoopie Pies

      November 22, 2020

      Dessert

      Gingerbread Cream Sandwich Cookies

      November 13, 2020

      Dessert

      Soft Pumpkin Sugar Cookies with Bourbon Cinnamon Frosting

      October 26, 2020

      Dessert

      No-Bake Vegan Cheesecake Ghosts

      October 22, 2020

      Dessert

      Gluten-Free Apple Butter Whoopie Pies with Bourbon Cinnamon…

      October 17, 2020

      Dessert

      Caramel Apple Crumb Bars

      October 14, 2020

      Drinks

      Purple Passion Blender Juice

      June 8, 2020

      Drinks

      Orange Sunrise Blender Juice

      May 3, 2020

      Drinks

      Blender Beet Juice

      April 21, 2020

      Drinks

      Peanut Butter Banana Dalgona Smoothie

      April 15, 2020

      Drinks

      Blender Green Juice

      April 5, 2020

      Drinks

      Iced Matcha Dalgona Latte

      April 3, 2020

      Drinks

      Matcha Latte

      February 26, 2020

      Drinks

      Vegan Italian Cream Sodas

      February 16, 2019

      Lunch & Dinner

      Butternut Squash Spinach Pasta

      November 30, 2020

      Lunch & Dinner

      Stovetop Vegan Mac and Cheese

      November 5, 2020

      Lunch & Dinner

      Vegan Gluten-Free Pumpkin Mac and Cheese

      September 28, 2020

      Lunch & Dinner

      Baked Potato Gnocchi

      September 26, 2020

      Lunch & Dinner

      One-Pot Creamy Vegan Taco Pasta

      August 31, 2020

      Lunch & Dinner

      Bourbon Cherry Kale Salad with Almond Oat Granola

      July 27, 2020

      Lunch & Dinner

      Tomato Ricotta Galette

      July 20, 2020

      Lunch & Dinner

      Asparagus Shallot Tart

      June 23, 2020

      Make Your Own…

      Naturally Sweetened Instant Pot Apple Butter

      October 1, 2020

      Make Your Own…

      Cinnamon Sugar Cookie Cereal

      July 6, 2020

      Make Your Own…

      Vegan Marshmallows

      June 29, 2020

      Make Your Own…

      Mini Everything Bagels

      June 15, 2020

      Make Your Own…

      Homemade Vegan Ricotta Cheese

      June 11, 2020

      Make Your Own…

      Purple Passion Blender Juice

      June 8, 2020

      Make Your Own…

      Gluten-Free Vegan Naan

      June 2, 2020

      Make Your Own…

      Vegan Hollandaise Sauce

      May 29, 2020

      Recipe Roundups

      Vegan Thanksgiving Recipe Round-Up

      November 6, 2020

      Recipe Roundups

      25 Plant-Based, Gluten-Free, Vegan Recipe Roundup

      March 19, 2020

      Salads

      Watermelon Roasted Peach and Cobbed Corn Arugula Salad

      September 11, 2020

      Salads

      Green Bean Potato Salad

      August 17, 2020

      Salads

      Bourbon Cherry Kale Salad with Almond Oat Granola

      July 27, 2020

      Salads

      Creamy Grilled Romaine Salad

      March 19, 2020

      Salads

      Walnut Pear Sweet Potato Mason Jar Salads

      August 9, 2019

      Salads

      Spring Detox Mason Jar Salads

      April 6, 2019

      Salads

      Kaniwa Pear Salad

      March 10, 2019

      Salads

      Brussels + Roasted Cauliflower Grapefruit Salad

      November 1, 2018

      Side Dishes

      Gluten-Free, Vegan Green Bean Casserole

      November 10, 2020

      Side Dishes

      Browned Butter Bourbon Skillet Sweet Potatoes

      October 29, 2020

      Side Dishes

      Green Bean Potato Salad

      August 17, 2020

      Side Dishes

      Maple Sriracha Cauliflower

      July 14, 2020

      Side Dishes

      Ginger Dill Spring Peas

      April 9, 2020

      Side Dishes

      Creamy Dirty Mashed Potatoes

      March 29, 2020

      Side Dishes

      Creamy Grilled Romaine Salad

      March 19, 2020

      Side Dishes

      Cornbread Stuffing

      November 23, 2019

      Snacks & Appetizers

      Beet Hummus Hash Brown Toast

      January 7, 2021

      Snacks & Appetizers

      Candied Amaretto Trail Mix

      December 21, 2020

      Snacks & Appetizers

      Browned Butter Caramel Popcorn

      December 14, 2020

      Snacks & Appetizers

      Hash Brown Avocado Toast

      July 29, 2020

      Snacks & Appetizers

      Cinnamon Sugar Cookie Cereal

      July 6, 2020

      Snacks & Appetizers

      Vegan Abstract Yogurt Popsicles

      July 2, 2020

      Snacks & Appetizers

      Blueberry Guacamole

      May 4, 2020

      Snacks & Appetizers

      Salted Cacao Caramel

      April 17, 2020

      Soups

      One-Pot Smoked Paprika Corn Chowder

      September 19, 2020

      Soups

      Spinach Artichoke Gnocchi Soup

      January 17, 2019

      Soups

      Curried Butternut Squash + Lentil Soup

      November 26, 2018

      Soups

      Slow Cooker Broccoli “Cheese” Soup

      October 3, 2018

      Soups

      Slow Cooker Lasagna Soup

      September 12, 2018

      Soups

      Baby Bok Choy + Shiitake Red Curry Soup

      May 4, 2018

      Soups

      Creamy Pumpkin Soup with Crispy Chickpeas + Pomegranate…

      October 7, 2017

      Soups

      Miso Tahini Ramen Noodle Bowls

      September 30, 2017

  • My Books
    • Moon Milk
    • 7-Day Vegan Challenge Recipe eBook
  • About
    • Work With Me
    • Contact
    • My Health Story
  • Food Photography
  • Shop
  • Search…
[slide-anything id="6097"]
Dessert

Chocolate Peppermint Cake with Pitaya Peppermint Frosting

by Gina Fontana December 5, 2019
written by Gina Fontana December 5, 2019
Jump to Recipe

A deliciously moist and fluffy gluten-free, vegan chocolate cake with a peppermint buttercream frosting garnished with sugared cranberries and rosemary sprigs. A holiday classic with a touch of pink!

holiday dessert recipes

This is a sponsored post written by me on behalf of Suncore Foods. The opinions and text are all mine. The product mentioned in this post was sent to me as a gift to use in this recipe, thank you so much Suncore Foods!

gluten free dessert recipes

When I think of peppermint holiday desserts, red or green come to mind, like fresh mint sprigs. But I decided to go pink this holiday season and frost my Chocolate Peppermint Cake with the most beautiful shade of pink! The frosting is naturally colored by the way, with Pitaya Powder from Suncore Foods!

Suncore Foods
pitaya powder

It’s not uncommon for me to talk on my blog about how challenging gluten-free vegan baking can be. There have been countless fails, lots of dollars straight to the garbage (which, ya’ll know it drives me nuts to throw food away!), and plenty of opportunities for me to give up baking all together. BUT, I am also not a quitter- maybe I drive myself a little crazy trying to perfect a recipe or get something just right- but I’m sure glad I stuck with it because this gluten-free, vegan Chocolate Peppermint Cake with Pitaya Peppermint Frosting is totally worth all those baking fails.

Vittle Club
vegan dessert recipes

Other than the cake turning out so moist and delicious, with just the right amount of chocolatey goodness to compliment the peppermint, I had a blast decorating this cake! Holiday cake decorating is my fav, which is really good since I may have to make holiday cakes the rest of my life, with my son being born on Christmas Eve!

gluten free cake

So what makes this cake so moist and delicious? Aquafaba. Aquafaba is a dear friend of mine. I think that was the aha moment, when everything in my gluten-free, vegan baking world clicked. If you’re not familiar with aquafaba, it’s the liquid in a can of chickpeas. Weird, huh?! Pure geniusness if you ask me. It whips up like egg whites and makes your vegan baked goodies so moist, like eggs would! I rave about it often, I’m sure you’ve noticed I’m totally crushing on aquafaba lol.

chocolate cake

So for the Chocolate Peppermint Cake I used gluten-free flour, baking soda, baking powder, salt, vanilla, peppermint, aquafaba, coconut milk, cocoa powder, chocolate chunks, agave, and date syrup! Completely naturally sweetened! Because I use organic powdered sugar for my Pitaya Peppermint Frosting, I wanted to keep the cake naturally sweetened, because we all know (no matter how much we want to deny it) that too much sugar will put your straight on the naughty list. Haha.

cake photography

The Pitaya Peppermint Frosting is a buttercream frosting made with vegan/plant butter, peppermint, organic powdered sugar, and Pink Pitaya Supercolor Powder from Suncore Foods. Now, I feel like the holidays are all about balance, right? It’s ok to indulge a bit, but I sure do feel better when I can sneak some superfoods in my baked goods like I did with this Chocolate Peppermint Cake with Pitaya Peppermint Frosting recipe. Not only does the pink pitaya powder give it this gorgeous pink hue naturally, but it also packs some pretty great health benefits and nutrients too!

holiday dessert recipes

Pitaya, also known as Dragon Fruit, is a rather exotic fruit. If you’ve ever had them, they are just as gorgeous in their whole form as their powdered form. Dragon fruit has rightfully earned its exotic reputation for vivid color, but the fruit is as healthy as it is beautiful. They contain many antioxidants, antibacterial, and nutritional properties help smooth the digestive process and boost the immune system and metabolism. This super fruit is loaded with Vitamin C, several types of Vitamin B, protein, fiber and essential polyunsaturated fatty acids.*

Suncore Foods pitaya powder
cake recipes

See? Healthy cake. LOL. No, but in all seriousness, this cake is definitely a lot healthier than alternative options you might be exposed to this holiday season but I promise, just as delicious. OH! And in case you were wondering, pitaya powder is pretty much flavorless, so it won’t add any weird flavor to your icing. It’s actually my favorite superfood powder to work with, and because duh, it’s pink! 😉

chocolate cake recipes

I chose to decorate my Chocolate Peppermint Cake with Pitaya Peppermint Frosting with sugared cranberries and rosemary and peppermint candies, but that’s completely optional. The cake and frosting taste great without all the embellishments, but if you’re up for some snazzy holiday decorating, have at it!

healthy dessert recipes

So head on over to Suncore Foods or to my Amazon Shop to get your Pink Pitaya Supercolor Powder, and get baking! Be sure to tag me on  Instagram or Facebook if you make this delicious cake recipe! Also, check out my Pitaya Poached Pears, Galaxy Meringue Pops, or Pink Pitaya Moon Milk recipes for more ways to use your Pink Pitaya Powder! Wishing you a pretty pink holiday season!

Continue to Content
healthy dessert recipes

Chocolate Peppermint Cake with Pitaya Peppermint Frosting

Yield: 6-8 people
Prep Time: 15 minutes
Cook Time: 35 minutes
Additional Time: 1 hour
Total Time: 1 hour 50 minutes

A deliciously moist and fluffy gluten-free, vegan chocolate cake with a peppermint buttercream frosting garnished with sugared cranberries and rosemary sprigs. A holiday classic with a touch of pink!

Ingredients

Chocolate Peppermint Cake

  • 2 cups gluten-free 1:1 baking flour
  • 1 teaspoon baking soda
  • 2 teaspoons baking powder
  • 1/2 teaspoon salt
  • 1 cup date sugar
  • 1/4 cup unsweetened cocoa powder
  • 1/4 cup agave syrup (or maple syrup)
  • 1 teaspoon pure vanilla extract
  • 1/2 teaspoon pure peppermint extract
  • 1 can aquafaba (the liquid in a can of chickpeas)
  • 2 teaspoons cream of tartar (whipped with the chickpea brine)
  • 1 can coconut milk
  • 1/2 cup dark chocolate chunks/chips

Pitaya Peppermint Frosting

  • 1 cup vegan/plant butter
  • 4 cups organic powdered sugar
  • 1 teaspoon pure peppermint extract
  • 2 tablespoons Suncore Foods Pink Pitaya Supercolor Powder

Decorations (Sugared Cranberries/Rosemary Sprigs)-optional

  • 1 cup fresh organic cranberries
  • fresh rosemary (about 4-6 sprigs)
  • 1/2 cup organic cane sugar
  • 1/2 cup water
  • 1-2 cups sparking sugar

Instructions

Sugared Cranberries + Rosemary

  1. If you're decorating your cake with sugared cranberries and rosemary, make these first.
  2. Place ½ cup granulated sugar and ½ cup water in a small saucepan.
  3. Stir together while heating over medium-high heat.
  4. Continue to stir occasionally until sugar dissolves and mixture begins to boil.
  5. Remove from heat and add the cranberries (you may have to do this in a couple different batches)
  6. Allow the cranberries to sit for 4-5 minutes in the sugar water mixture.
  7. Using a slotted spoon, remove cranberries from the saucepan and place on parchment paper for 10 minutes (making sure they aren't touching).
  8. Repeat with other cranberries and the rosemary sprigs.
  9. Place your sparking sugar in a medium bowl.
  10. Add a few cranberries at a time and use fingers or small spoon to gently roll in the sugar to coat completely on all sides (be sure your cranberries don't stick to eachother).
  11. Remove and place on a parchment lined baking rack to dry.
  12. Repeat with all cranberries and rosemary sprigs.
  13. Let them dry at room temperature for one hour. Store leftovers in the fridge.

Chocolate Peppermint Cake

  1. Preaheat your oven to 350 degrees F.
  2. Whisk together all dry ingredients in a medium bowl (except for dark chocolate chunks/chips.
  3. In your KitchenAid mixer (or alternatively you can use a hand beater with a large bowl), beat your aquafaba (the liquid from a can of chickpeas) on high until it starts to froth up. Add the cream of tartar as it starts to thicken. It's done when stiff peaks form and it resembles whipped egg whites.
  4. Add the liquid ingredients to the bowl with the whipped aquafaba (this will cause it to deflate).
  5. Finally add in the dry cake mix to the bowl and blend until a nice smooth batter forms.
  6. Fold in the chocolate chunks/chips.
  7. Spray 2 6-inch cake pans with coconut oil and place them on a large baking sheet (makes it easier to take them out of the oven).
  8. Fill each pan equally with the cake batter and bake for 25-35 minutes, until a toothpick inserted in the middle comes out clean.
  9. Move the cakes to a cooling rack and cool for about an hour before frosting

Pitaya Peppermint Frosting

  1. In your KitchenAid Mixer (or bowl with hand blender) beat the butter, vanilla, and peppermint until its smooth.
  2. Slowly add in your powdered sugar, 1/2 cup at a time and continute beating while you do so.
  3. Finally, add the Pitaya Powder.


Frosting and Decorating

  1. When your cakes are cool, place one cake onto a cake platter or flat dish. NOTE: you may need to slice the top off the bottom cake to make sure the other cake will sit flat on top of it.
  2. Add a generous amount of frosting on the top of that cake.
  3. Add the other cake on top of it, making sure it's stable.
  4. Spread the remaining frosting over the whole cake (you may have a little leftover frosting).
  5. Decorate with sugared cranberries and rosemary sprigs (and peppermint candies if desired).





Notes

* best if eaten within a day or two

Did you make this recipe?

Tag @healthylittlevittles on Instagram and hashtag it #healthylittlevittles

© Gina Fontana
Cuisine: American / Category: Dessert

CLICK BELOW TO PIN!

* nutritional information provided by Suncore Foods

160shares
  • Facebook
  • Email
cakechocolatedessertegg freegluten freenaturally sweetenedpinkpitayasweetsvegan
Gina Fontana

previous post
Cookie Dough Stuffed Dates
next post
Superfood Puppy Chow

You may also like

Browned Butter Caramel Popcorn

December 14, 2020

Vegan Gingerbread Crème Brûlée

December 5, 2020

Hot Cocoa Whoopie Pies

November 22, 2020

Leave a Comment Cancel Reply

Save my name, email, and website in this browser for the next time I comment.

This site uses Akismet to reduce spam. Learn how your comment data is processed.

Search

HEALTHY LITTLE VITTLES is a food blog created by certified health coach and published author, Gina Fontana, that focuses on gluten-free + vegan + plant-based recipes. Here you'll find simple, flavorful meals, many made in 30 minutes or less! All eaters are welcome, there is a little something here for everyone!

My First Published Book!

Purchase

On Instagram

healthylittlevittles

Gina | Healthy Little Vittles
There’s nothing like a classic peanut butter coo There’s nothing like a classic peanut butter cookie. But make it gluten-free, grain-free, vegan and naturally sweetened and add sea salt on top for the perfect salty sweet treat!
.
Sorry to tease you... but this recipe will be in my new dessert book, so you’ll have to wait, but promise it’ll be worth it 🧡
GREEN GODDESS PESTO BOWLS: packed with nutrients, GREEN GODDESS PESTO BOWLS: packed with nutrients, made in just 30-minutes, and is so tasty you’ll forget it’s actually good for you! You can certainly modify it to include whatever veggies you’d like. In this version I chose to include:
☆ potatoes
☆ kale
☆ brussels sprouts
☆ crispy chickpeas
☆ toasted pumpkin seeds
☆ my favorite pea pesto from @minimalistbaker

Head to the blog for the full recipe! Clickable link in bio @healthylittlevittles
.
https://www.healthylittlevittles.com/green-goddess-pesto-bowls/
You guys really loved these when I posted them a l You guys really loved these when I posted them a little while back so I decided to share this BEET HUMMUS HASH BROWN TOAST recipe on my blog! The beet hummus is so delicious topped with sautéed balsamic mushrooms, avocado, vegan parmesan cheese, and fresh microgreens 💗🌱 They make a great appetizer, lunch, dinner or even savory breakfast! Basically they are perfect any time of day. SWIPE to see a closeup! 👉🏻
.
BONUS: use @strongrootsusa cauliflower hash browns for extra yum factor 😋
.
Clickable link in bio @healthylittlevittles

https://www.healthylittlevittles.com/beet-hummus-hash-brown-toast/
Besides being nature’s candy, poached pears are Besides being nature’s candy, poached pears are super easy to make and look so pretty! Serve with coconut whipped cream, ice cream, or even chocolate sauce. You know what?! Treat yo’self and you just go ahead and enjoy with all the above 😉 This recipe will be in my new book! Who’s excited?! 🥳💗
One of my most popular blog recipes in 2020... and One of my most popular blog recipes in 2020... and I think will continue on in 2021 is this BUTTERNUT SQUASH + SPINACH PASTA! It’s made in under 30 minutes and is so so good 😋 Recipe is on the blog! Clickable link in bio @healthylittlevittles
.
https://www.healthylittlevittles.com/butternut-squash-spinach-pasta/
Have you made sushi at home before? It’s really Have you made sushi at home before? It’s really quite simple... it takes a little practice but I know you can do it! I think making more sushi at home could totally be an attainable goal in 2021 🍣🥢 SWIPE to see a video of just how simple this SHIITAKE KALE PLUM SUSHI is to make! 👉🏻🎥 and then head to the blog for the full recipe, clickable link in bio @healthylittlevittles
.
https://www.healthylittlevittles.com/shiitake-kale-and-plum-sushi/
Happy New Year! 🥳🎉✨ I have some delicious Happy New Year! 🥳🎉✨ I have some delicious recipes coming this year, both savory and sweet! Like this better-for-you Avocado Chocolate Pie! You’ll have to wait for this one though, it’ll be in my new book! A “new you”in the new year doesn’t have to mean skipping out on things you love, just finding a different way of indulging 😉
TOP POST OF 2020! ✨ you guys have great taste be TOP POST OF 2020! ✨ you guys have great taste because these APPLE BUTTER WHOOPIE PIES are definitely one of my favorite recipes of 2020 as well.
.
Happy New Year to you my friends, wishing you many healthy blessings in the new year ❤️🎉
See more... Follow on Instagram

Learn Food Photography!

As Seen In…

FeedFeed
  • Facebook
  • Twitter
  • Instagram
  • Pinterest
  • Youtube
  • Bloglovin

AFFILIATE DISCLOSURE
My blog contains affiliate links, which means I receive a percentage of the sale if you use the link to featured products to make your purchase. This does not change the price of the product. This income directly offsets the cost of web hosting and maintenance so I greatly appreciate your support. Gina is a also a participant in the Amazon Services LLC Associates Program, an affiliate advertising program designed to provide a means for sites to earn fees by advertising and linking to amazon.com

COPYRIGHT © 2019 REGINA ANN FONTANA, LLC
Privacy Policy


Back To Top